DPCstruct | MC552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 6.50 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 51.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10929 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M2PV75 | 1-65 | MQPTISLVADIPEELFESLQSYLESHPDWDHDRVVAAALSLFLLQNGNNDRRAARVYLDTLFKQP |
| A0A235IAX1 | 2-70 | KSTVSIFTEIPETLHESLKNYLETHPDWDENRVLTAALSLFLLQNGDSDRRAARVYLETLFHHSTVEMS |
| A0A2W6ZQ57 | 37-97 | None |
| A0A316JPJ5 | 67-138 | None |
| A0A4P6LAZ5 | 3-71 | None |
| A0A2E0AIA8 | 13-81 | None |
| A0A089PDZ3 | 11-86 | None |
| A0A7G8IZN9 | 8-91 | None |
| A0A4P5VEF5 | 55-125 | None |
| A0A4P7ZW39 | 16-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.