DPCstruct | MC55195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 233 ± 46 aa |
| Standard deviation of domain lengths | 46.12 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9DJ70 | 46-279 | LVFVIRLWLFVVPKLPSANVQPPQGAQISRSSTLSEVMSISFPGTSSTKIEELSDDFSAKSLIRKGGFDFEITADLDKHLTFDPNCR… |
| A0A428TWV3 | 78-281 | DNQPSGLLELGTQPIQWHSNNSLVDFMAKVFPQADTGNLHVRDDSGRIRDIKSTITARRLKKVARLRFQGTDDLRNHLKMDVKEGVV… |
| A0A066X1S3 | 36-238 | None |
| T0LTB5 | 29-199 | None |
| A0A1J7JUY8 | 205-446 | None |
| A0A2V1CTD9 | 4-183 | None |
| A0A2V1CSU6 | 12-181 | None |
| A0A093Y311 | 416-574 | None |
| A0A317WZ55 | 111-330 | None |
| A0A366S5E9 | 5-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.