DPCstruct | MC55183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 8.31 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6C6Y5 | 3-81 | AGGIHYEPFGIYPGKKETLDDLEDGDTIAVPNDTTNEARALLLLQDNGVITLKDGAGLEATVKDIEENPKNIKIEELEA |
| A0A6M1CI75 | 60-148 | MAGYSDKIKNISELKTGDTIAMPNDPTNLGRALLLMEKEKLIKLKSGTGLLPTALDITENPLKLNIMELEGAQLPRVIKDPKVTVAI… |
| A0A377ZM74 | 13-107 | None |
| A0A1G7UZ44 | 2-103 | None |
| A0A7H4MM92 | 35-118 | None |
| A0A3P3XQE0 | 1-90 | None |
| A0A7L5Y1P0 | 149-235 | None |
| A0A1H3AQS6 | 19-110 | None |
| A0A0A2W5V2 | 101-192 | None |
| A0A377ZSB8 | 39-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.