DPCstruct | MC55180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 153 ± 16 aa |
| Standard deviation of domain lengths | 16.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12520 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395HF86 | 3-156 | HMFVAPPEEECLIQTSESSFRTARVSPMEQFELRYRQVWLYAMRHYPLMPPDPKTDAKLFANFNRAKADEHTVCEMARLAYRLGFRS… |
| A0A6A6I425 | 33-231 | LGIFFEMLKYLEPICDTLKQLIRTKMKGTIRRSLFGSFFPPEKVTVQKSESHAMELRGQLDKAAEIAYIQLWAFCARHFNGLTTFTP… |
| A0A4Z1L298 | 378-510 | None |
| A0A7R7VE23 | 137-278 | None |
| A0A084BCK0 | 361-512 | None |
| A0A5N6X1H1 | 466-606 | None |
| A0A1V8S7G2 | 124-258 | None |
| A0A2H3FKE2 | 370-493 | None |
| A0A4V3SIE6 | 7-187 | None |
| A0A0C3GBH3 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.