DPCstruct | MC55178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 223 ± 47 aa |
| Standard deviation of domain lengths | 46.69 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 70.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11819 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7EP01 | 2-163 | KLKHQELQDRLEICILELKKLCIREAELTGQLPKDYPLLPGEKPPQIRRRIGAAFKLDEQNIPQGSENSELTLVDVDLALQTKIYEA… |
| A0A3Q2CXN1 | 5-199 | ESKEEISDSDSGIILHSPDSPTSPVKDLTTHTRALKLKHQSLEERLELCLLELRKLCIREAELTGSIPSDFPLMPDEKPPRVRRRIG… |
| A0A158PK64 | 7-292 | None |
| A0A0S7F1H7 | 3-201 | None |
| K7FHM9 | 1-190 | None |
| A0A139WNV6 | 8-186 | None |
| A0A834JSH5 | 2-186 | None |
| A0A7J8EI21 | 4-191 | None |
| A0A2A2JPU6 | 40-343 | None |
| A0A2A2JPG7 | 40-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.