DPCstruct | MC55176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 211 |
|---|---|
| Mean domain length (aa) | 186 ± 36 aa |
| Standard deviation of domain lengths | 36.09 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 12.84 |
| Pfam Score | 26.42 |
| Assigned Pfam label(s) | PF15384- PF09302- PF06632- CL0097- PF16531 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4ZKD3 | 19-206 | RSWQKFELEGQNFLLKTHVDHREGYEFLFTDLTCLWHEKMDKEEVKKRCKTLNPRFEAPLPTILRLLQDNTETKKDSTDYTIQHQGE… |
| A0A3Q2CGU8 | 16-186 | PWLPVTIDGVQLLSKPWFGETAYRILLTDMQSVWEEKIEAAAVEKRSQELNRRLRASAAAFFSHLCEVAQPCLSGGQQTGGEVQMSV… |
| A0A668W0P8 | 1-157 | None |
| A0A812YAP6 | 506-687 | None |
| A0A1Y1V4W9 | 162-451 | None |
| A0A1A9ZXB9 | 1-221 | None |
| A0A1S3MSA8 | 15-243 | None |
| A0A1J8PN33 | 34-197 | None |
| A0A5E4PVY5 | 3-125 | None |
| A0A815TMT7 | 3-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.