DPCstruct | MC55174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 263 ± 45 aa |
| Standard deviation of domain lengths | 44.89 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0UWA4 | 1-242 | MNVLTSLDVLIGLIVIFLVVSLACTVINEWIDALLHTRAQQLRNSISQMLSSSNDSSLGQKFHTHPLVQALERDTNVWGIYKRRDKP… |
| A0A238Z1T9 | 5-303 | STLDLTIGLIFIYLVLSLLCTSANEAIAGLLRLRARILFSEVSRMIEVDDVNAAFWSSGLVRSLGHSIGIPDSTKGNRAPSYMESNT… |
| A0A838L9C9 | 4-325 | None |
| I4GF60 | 1-224 | None |
| A0A7U3G7Y1 | 57-306 | None |
| A0A6B0YJJ3 | 1-229 | None |
| A0A532D4Q0 | 1-345 | None |
| A0A840L6J5 | 1-219 | None |
| A0A7I8N2G4 | 3-308 | None |
| A0A542LV50 | 5-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.