DPCstruct | MC5517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 106 ± 15 aa |
| Standard deviation of domain lengths | 15.41 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 69.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K5ZST1 | 8-99 | AKFMLNMTGGICMIALVVGIVMWLWNWLVPSITGWSNINYWQALGLTLLFRFLNGNILPPMFHIKKRGSFEKMKKMSVEERSAFIRR… |
| A0A6L9EFC0 | 5-115 | HSQKSKIEKFVTVVFWVIFGTIAMIAFALLFGYIVMLLWNWLMPSLFGLGTLNFWQAVGILILAKILFGGFGSGKSGRRSKRVRSKV… |
| A0A8B3CGE1 | 3-119 | None |
| A0A841RD84 | 20-148 | None |
| A0A1F5B648 | 1-151 | None |
| A0A7C2R1W4 | 10-109 | None |
| A0A0F9HPP9 | 19-133 | None |
| A0A2N2N8C8 | 13-114 | None |
| A0A1H2UCY6 | 12-137 | None |
| A0A3D4TY83 | 2-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.