DPCstruct | MC55164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 72 ± 10 aa |
| Standard deviation of domain lengths | 9.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13986 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D4INM0 | 1-67 | MNEYLSASDLAELVGCKPNQRAMMARWLNRHGWRYVVDKNGIPRVLRAYRDKKLGVVDGQQKAGLTS |
| A0A6I1I7I6 | 75-141 | ETLTAEELETISGCCRKVDQIKWLQQNGWTFIRNRAGAPIIGRLYARLRLSGINPASLVSTPAWAPD |
| A0A3E0BZA6 | 1-96 | None |
| A0A139BU83 | 3-66 | None |
| A0A1T1ANX8 | 1-68 | None |
| A0A2N2S1N6 | 1-57 | None |
| A0A849BIM2 | 24-97 | None |
| A0A679GGC4 | 41-106 | None |
| A0A1G7NCV3 | 1-74 | None |
| H8Z1A7 | 4-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.