DPCstruct | MC55162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 194 ± 39 aa |
| Standard deviation of domain lengths | 38.59 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A533YRZ9 | 5-180 | RLRKYFAVASILFMVVLAVSPLKDFFREWRFYQYRFNNLVADLPKKVKPAEIGIKQIWNRKLDRVDRCITCHLGIKEEALKGAEQPY… |
| A0A836VZE2 | 1-158 | MDDARVRRMKILLLTSSLVCLALLLLAAYEENFTAEWRGYQQQYASRLRELAAATGKPAIDYPVEVRQIYLEGLGRVDRCVNCHVAI… |
| A0A1F2RQM3 | 6-198 | None |
| A0A1V5X861 | 7-196 | None |
| A0A3M2JSW4 | 3-179 | None |
| A0A521WP11 | 6-192 | None |
| A0A1F9N175 | 12-193 | None |
| A0A2V8K337 | 205-520 | None |
| A0A3M1R893 | 1-194 | None |
| A0A7C1N5H0 | 1-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.