DPCstruct | MC55160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 164 ± 24 aa |
| Standard deviation of domain lengths | 23.81 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 20.23 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | CL0368- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A533YKK9 | 12-180 | MTAPTHVTFAEFVYLLLLTTTGVSLNPVNAAAIALSSLLPDVDTAASSIGRLLPVVSLKLERRFGHRTITHSAIFIAAIAIVTFPLS… |
| A0A842LZG8 | 1-149 | MYSRGHIGLSLIIISLLLKTLGVNPDSLTISTFVLLFSTFPDIDLKLGTAHRGLSHSIFFSVLIAFLFSLILYRLSGDQNLLFTSFT… |
| A0A7V3W8I7 | 27-213 | None |
| A0A831SL96 | 1-165 | None |
| A0A4R1PC71 | 57-204 | None |
| A0A1F3YBT7 | 7-187 | None |
| A0A7G6DZ20 | 44-229 | None |
| A0A7G6DZV5 | 11-166 | None |
| A0A535A3A2 | 4-178 | None |
| A0A2T2RN00 | 24-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.