DPCstruct | MC5516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 4.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 72.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8N4W8 | 1-79 | MYVRYSFHNSFRNNQFMGRLEYYKGTYNKSEYLELRRIWVSDPYGLTDKVQPVNPTWGMEGFNPFVLGGIASHHIATGT |
| A0A287EA03 | 66-144 | IHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQAVNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSV |
| A0A814RG48 | 147-219 | None |
| A0A287U567 | 2-65 | None |
| A0A7J8N1F4 | 2-72 | None |
| A0A7J9HTE2 | 26-98 | None |
| A0A6V7NEV5 | 12-84 | None |
| A0A6A4NTL6 | 165-235 | None |
| A0A7J8MUT9 | 26-101 | None |
| A0A0D3GJW3 | 16-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.