DPCstruct | MC5515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 107 ± 10 aa |
| Standard deviation of domain lengths | 10.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8IVD3 | 151-258 | TTSTPTPLENLGPVQQKLAKNTNLASKLQARLPAGTNLMEAADGFRNLGQFVAAVNVSNNLNVPFDKLKADMVTKKMSLGQSIQDLR… |
| A0A2V9B357 | 6-117 | PGSVLEHNSNLATKLETLTGATNLTDLKTDASAFKNFGQFVAAAHVSKNLNIPGGFAALMCDMTGKTAVGATSPCTNTTKMSLGKAI… |
| A0A3N5FU27 | 4-106 | None |
| A0A1Q6WET7 | 11-112 | None |
| A0A5C7T3H3 | 2-87 | None |
| A0A3N5NYC5 | 104-228 | None |
| A0A7Y5U4J2 | 7-109 | None |
| A0A202B4G0 | 5-105 | None |
| A0A534FFF4 | 34-153 | None |
| A0A7V0UGH4 | 118-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.