DPCstruct | MC55138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 324 ± 22 aa |
| Standard deviation of domain lengths | 21.72 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 24.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3NDB7 | 1-335 | MPEPTRRQNSADAKSALLQQVAARLELPAGRWDDAVAAQFDLLRAAVLAAEEQTGSPARMAEVLRALGQLKRQLLTRAAAPFAEPPR… |
| N6Z8I3 | 129-442 | HVSPRLACLDDLEAWLVRLRRLARDKGATGRLKVAERQLADALFAVVQHPDESAHWQTVVTALANVETVLLSSGNVRCGPIPPLRPE… |
| A0A3C1GJR2 | 19-321 | None |
| A0A532DEP5 | 1-311 | None |
| A0A238ZY52 | 243-572 | None |
| A0A2S2CKC4 | 397-762 | None |
| A0A6P2D3X5 | 84-369 | None |
| A0A7C3T626 | 72-418 | None |
| A0A1G1CFT2 | 351-681 | None |
| A0A7C4UP98 | 207-522 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.