DPCstruct | MC55134
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 161 ± 14 aa |
| Standard deviation of domain lengths | 14.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3EMP9 | 595-765 | AEVLRQNPPPVELPAAPTVMAEKTPLAKALIAAPQPPIVPAIADDRLKPWTDRLHERIRENVGKDARPTAFLALTGGTPEKVRIVAA… |
| A0A1G0Z2F0 | 231-374 | LKQIERRRYKYISEIKENLVRILERNPYTGAIKLQNGSTINGTIAMANEATAIVRVGNAKGKAYKWKELHIELFIAMANHYAEQRLS… |
| A0A7V2XTJ4 | 685-843 | None |
| A0A7V2V0T3 | 968-1108 | None |
| A0A7V2XUK9 | 743-897 | None |
| A0A7V2V2P6 | 415-585 | None |
| A0A7V3ADK9 | 493-658 | None |
| A0A660VZ25 | 638-826 | None |
| A0A7V3AFQ8 | 663-817 | None |
| A0A1Q7V0B1 | 97-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.