DPCstruct | MC55126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 495 |
|---|---|
| Mean domain length (aa) | 315 ± 98 aa |
| Standard deviation of domain lengths | 98.39 |
| Length coefficient of variation | 0.31 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 17.63 |
| Pfam Score | 99.07 |
| Assigned Pfam label(s) | CL0123- CL0735- PF02502- CL0507- PF01425 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1GH21 | 113-376 | VENPLAEGYSSGGSTSGGAALDKLDDRILGAPPRGSASFTESLRPTLSGATGFMVGILVEGFEHQLVGPPIKDLVMRAARRFETLGA… |
| A0A1Q9XX24 | 7-264 | AAKDSYLIKGLTAASGSPAFKDLVAQRDAFTIERLRAAGVICPGKTNMPPMANGGMQRGVYGRAESPYNANYLTAPFASDSSNDAGT… |
| C3ZYN5 | 15-224 | None |
| A0A1Q6XI16 | 8-181 | None |
| A0A0F7RZM9 | 102-360 | None |
| A0A2U8G7Q7 | 8-214 | None |
| A0A3S1A1Q2 | 7-265 | None |
| A0A7R9A5S4 | 289-699 | None |
| A0A0G4HZD7 | 17-286 | None |
| H0EJT4 | 114-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.