DPCstruct | MC55111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 240 ± 50 aa |
| Standard deviation of domain lengths | 50.47 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 74.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15481 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J9XLY3 | 6-262 | QNCAEGCLKPFLLTLRANFVSGNNYERLVNTCEKLSEVYECMDRIKKCQPNYLFRIFMDGFEYMCIEHPAAFRDLMECMDLHTQIVT… |
| H3F4E7 | 8-226 | LAALAYSAPTPQNPSCLEKCLVAGGIVGAAADLNFFKSVAVDINNFCNVYTALLKCASGCSQDDLNLVMKHTMHASYVCKEKLEEIK… |
| A0A3P7J2U5 | 2-257 | None |
| A0A0M3HS81 | 270-489 | None |
| A0A2H2I6A9 | 104-496 | None |
| A0A2A6C0G4 | 77-395 | None |
| A0A0D8XWD4 | 247-593 | None |
| Q52GY3 | 11-221 | None |
| A0A2A2KQM3 | 684-878 | None |
| A0A0N4ZYV4 | 2-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.