DPCstruct | MC5511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 73 ± 4 aa |
| Standard deviation of domain lengths | 4.34 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 27.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L5LKM6 | 30-104 | HNRNITKEKATEVAIQHMKKEENIDFVVTDVKIEHLELAGFITVSGYDKNNKQERYHVMINKTQNYTIEFWGKIK |
| A0A2C2UQD7 | 14-87 | QKKEAMIQKSKEVAIATIKKDLGVEMVVTSYQLEPTIQIIFINGHPNDDKNNKLSVSISYEENYLVTSIGYDYL |
| A0A2N5MBU0 | 2-75 | None |
| A0A5B0DJK0 | 15-83 | None |
| E0RG15 | 32-108 | None |
| A0A0Q7S2W7 | 2-78 | None |
| A0A2B2BS33 | 8-83 | None |
| A0A1S2C1G4 | 13-83 | None |
| A0A2I0RG40 | 3-68 | None |
| A0A1I2ZC20 | 22-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.