DPCstruct | MC55103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 343 ± 33 aa |
| Standard deviation of domain lengths | 32.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C5TIZ3 | 1-326 | MSTGLQVVNQEQLPENVRNEIDSEIDKIIERHKNNRYEINKLVFESVAALTSSENYSNELASQGIFKRFWGGITGKNRALQTEISRN… |
| A0A0F6H6G0 | 4-363 | LNLADHYKLAGLNPGPEIINLRKESFDKISSELNNAKIIELVRIYFGFPTTKEFDWFRNGFAEKDSSFTLIDNQNEAAVLAAALLRS… |
| A0A5C8EVC8 | 1-383 | None |
| H8GGB1 | 4-327 | None |
| X8HHV5 | 8-362 | None |
| A0A0P0F645 | 4-346 | None |
| A0A2A5M0Z1 | 346-678 | None |
| A0A7W3V143 | 7-315 | None |
| A0A1C4F9J7 | 1-390 | None |
| A0A285S775 | 2-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.