DPCstruct | MC55100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 153 ± 7 aa |
| Standard deviation of domain lengths | 6.77 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 78.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2MTN0 | 12-167 | IFILAALFITSCSDEDTAVSEQEIENYTEDAIYTMQRHAMCGVRGCFEFMFPITIIFPDGGEAEVDSYEEMRDRIRRWKTDNPDAET… |
| A0A7Z1RB62 | 1-161 | MFFNCQNETVNSVDQQSETLEYNSTLFNLISTMALDEDINCLDFEYPLTVSIYDADLQLTDIVTINNDDALYLFLQTLDTSNVANLN… |
| A0A5S5C3F7 | 6-160 | None |
| S7WTS0 | 1-141 | None |
| F4KZI5 | 10-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.