DPCstruct | MC5510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 7.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A518DHG0 | 994-1063 | YDAARKAANNANRKIRRDQGLVGQKVDVHELKPVKFNGSPTDPANKAILDRDLHRKEVTPWWNRLQNNIE |
| A0A2N6KPN9 | 52-119 | YKNARKAANNANRKIHRKDPRAKGKEIHEVHPVKFGGSPTDSANKIYLDPAEHRKYTTWWNRIQRKMN |
| A0A374GC47 | 82-143 | None |
| A0A7C1PMQ6 | 216-283 | None |
| A0A3R8VRT9 | 302-370 | None |
| A0A0L6JX01 | 1-83 | None |
| B9NXZ7 | 115-182 | None |
| A0A4R7CDZ5 | 47-116 | None |
| A0A2E4NTW2 | 124-191 | None |
| A0A856MPK8 | 186-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.