DPCstruct | MC551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 86 ± 4 aa |
| Standard deviation of domain lengths | 3.95 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 31.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661XGJ2 | 79-161 | RVGLADGTADIFRMVQYDIMEAPLAAQYTGIKAFKGVSISNPYRTIRADWTMRGFRAVINDLDGKTYIDHYQRNDMSNCIVYY |
| A0A098G701 | 1-80 | MRQYQVMENSTMHPELGAKYPEIRTYDAYGVDDSSELVTLDITPQGFHAMILSPGKSPIFIDPLKREDTQYYMVYSWYFF |
| A0A7Z8YEY6 | 77-163 | None |
| A0A250FMA3 | 72-157 | None |
| A0A7X7T2R5 | 90-177 | None |
| F5XT71 | 81-168 | None |
| A0A0Q5UBU4 | 83-172 | None |
| A0A1M6ZJE8 | 76-157 | None |
| A0A350UZ82 | 48-139 | None |
| A0A1V5NCY8 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.