DPCstruct | MC55093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 68 ± 8 aa |
| Standard deviation of domain lengths | 8.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3BKJ3 | 1-64 | MAGSKEAATSEPAAKTPPQPGMVWVNTETGTYHREGDRWYGKTKVGKFMTEADAKQAGYREGKR |
| A0A537RKT3 | 67-132 | QSPALDKGQYTSEAEAKASCPSDAVVWVNSASKIYHPSGSRSYGKTATGAYMCEQDSIAAGFRAPK |
| A0A2V6YXA7 | 171-240 | None |
| A0A2V7UC72 | 217-278 | None |
| A0A2V9CFD4 | 151-211 | None |
| A0A2V7WQG3 | 207-279 | None |
| A0A5M8SGD8 | 114-197 | None |
| A0A7Y4H6Z6 | 1-68 | None |
| A0A2W0C006 | 188-257 | None |
| A0A525I9E4 | 8-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.