DPCstruct | MC55092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 164 ± 26 aa |
| Standard deviation of domain lengths | 25.50 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5F6H3 | 33-179 | APYFGGYIGNLNNVPTAPTFSVPYLLSLCQIDLVNNHQVFTRQNRVDTTQRGLKLLAYEGGQHLVGVGAAQSNQTLTNLFVTANRDP… |
| A0A7V2YYM3 | 39-161 | VDEILDTVAPAEIAIEQTHTIANKARADKQGWKLITYEGGQHFVGSSGAENDTTLTTILIAANRDPRMHTRYIEYLDMLQANGVETF… |
| A0A1U7HLZ9 | 470-628 | None |
| A0A7Y4WH51 | 382-573 | None |
| A0A7X4YPS5 | 624-796 | None |
| K9YXE2 | 415-582 | None |
| A0A3D9HRU4 | 353-511 | None |
| U2Z5N6 | 13-147 | None |
| A0A517YVL0 | 229-403 | None |
| A0A517YWH6 | 994-1138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.