DPCstruct | MC55086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8903 |
|---|---|
| Mean domain length (aa) | 189 ± 33 aa |
| Standard deviation of domain lengths | 32.53 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.34 |
| Mean intra-cluster sequence similarity (%) | 10.79 |
| Pfam Score | 90.63 |
| Assigned Pfam label(s) | PF12294- PF15756- CL0113- CL0110- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6QEQ7 | 31-196 | VTWDKWTANNGGWKIEGYVNADGKSNPITAYAAVDQNGPLVTVEWTVQFIEHTFSLGPAAGVHIMADASDPTKANSYLIFQDNGFIR… |
| A0A0D1IL93 | 6-164 | TSPSYNKFDCGENRSVQTYGYGLYEVRMKPAKNTGIVSSFFTYTGPTDGTPWDEIDIEFLGKDTTKVQFNYYTNGAGNHEKIVDLGF… |
| A0A7Y0N925 | 9-167 | None |
| A0A497NZN0 | 22-223 | None |
| A0A2D5WIY2 | 13-180 | None |
| A0A2D9MZG7 | 8-185 | None |
| A0A2D9MZY6 | 5-153 | None |
| W8KSK1 | 257-457 | None |
| A0A7W0Q3P7 | 26-222 | None |
| A0A194VBU8 | 29-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.