DPCstruct | MC55082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 193 ± 19 aa |
| Standard deviation of domain lengths | 19.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07758 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6NVE1 | 11-187 | FLALMILGAYINIPLWRRPTLVINVGGGLVPIVLTGYIMSRVGTQREWSRAIVATVITAVSIYAAGRLLPAEPGTMILDPTYLYAVI… |
| A0A432Q4J1 | 20-197 | LEVFVKYVEFSGFSRKDAITIVVLPLLAWIYLPPVKFGNIYNMTLYLSFSGFIIPVTVALKQIVTGNVNIKKVIFGTFLVAIVSYTV… |
| A0A3M1V820 | 125-323 | None |
| A6ULW2 | 18-237 | None |
| A0A7C6LBM0 | 13-207 | None |
| A0A7J3UZU7 | 161-361 | None |
| A0A7T5EHM4 | 19-206 | None |
| A0A1F9YUN1 | 8-219 | None |
| A0A2A2IBX9 | 1-178 | None |
| A0A2P6VWG9 | 11-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.