DPCstruct | MC55081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 324 |
|---|---|
| Mean domain length (aa) | 137 ± 20 aa |
| Standard deviation of domain lengths | 20.09 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 11.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14343 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6N8Q4 | 440-576 | TEVSPGSGSSRSRPVSLPFASHKIEGRSQAGCEVYLSPPGGKDLPEGIPALAGVRPEETVYIAIYLGKRPTGGYKITPVSVSLEKSR… |
| A0A845EL34 | 3-85 | AYFQKLQDEPTIEGYKTFTILEGNKSIILSLGEKMAGNDIEVLDVEEQSNTTIVKIRSYYNQSSEKNPVIGIGLDRLKENIVI |
| A0A7C4SMP1 | 23-149 | None |
| A0A1I0X2Y9 | 10-133 | None |
| A0A1Z3HR73 | 40-229 | None |
| A0A1F3UZQ7 | 24-141 | None |
| L9VVF7 | 123-260 | None |
| R6U6S0 | 158-326 | None |
| A0A1T3NL35 | 62-229 | None |
| A0A0K0GC05 | 2-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.