DPCstruct | MC5508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 244 ± 53 aa |
| Standard deviation of domain lengths | 53.35 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 18.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0055 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B0YSB3 | 40-335 | ADIAGPGLLTHIWMTQRNHYRDCLLKITWDNADQPSVLVPLGDFFGLGNALVNSYQSQLFTASTRWNNQFESGCALNCYAPMPFRER… |
| A0A7S4M8I4 | 19-264 | GYEDTIFRFYYDGETEPYTSAKLFQGMWHSSEYLFGSNGKSSFYITVKIPFEKSIRITAEIQTEANQPQLAYWSIRGLLDGPPVTVG… |
| D1W5Z3 | 189-467 | None |
| A0A1F3LQE1 | 59-204 | None |
| Q5AX82 | 135-316 | None |
| A0A2V8Z9Y4 | 94-360 | None |
| A0A6N8W5Q0 | 29-301 | None |
| A0A5C7PL56 | 1-322 | None |
| A0A7K3YWQ5 | 22-184 | None |
| A0A521GU20 | 220-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.