DPCstruct | MC55079
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 178 ± 29 aa |
| Standard deviation of domain lengths | 28.85 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6P947 | 3-197 | AQLQQNFPKIDKEVILKAWNWFEKINETMAVLTLLTENTTTLEQQENLLVLLKQFNTKVEKGKITQIWKSCNQFYFNTLVKLREICL… |
| X6MT64 | 57-245 | GDSKKIGDFLAFNVIMLAQFQQTFSKISKEIIIESFNCTTSQQQHHLMRLFKEFGDKLEKTMILQTWRNHNNIFVETRMKLMEICAT… |
| X6LZ85 | 27-254 | None |
| X6LW64 | 46-191 | None |
| X6LBA4 | 1-148 | None |
| X6P7E1 | 22-219 | None |
| X6P6I3 | 31-204 | None |
| X6P5X7 | 33-197 | None |
| X6P5Y4 | 1-159 | None |
| X6NXI3 | 101-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.