DPCstruct | MC55077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 186 ± 22 aa |
| Standard deviation of domain lengths | 21.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6PFK6 | 114-300 | FNSFSVIWNGEGGKFQFHREPLNPYSITLKQALQQLKQKLQVLRKFKHGMEKIIYFDCIFDRCVPPIPPNINENVLLHDIYKHIRNY… |
| X6MP70 | 1-199 | MEDDFIYKVPLNPYATTFENAKEYLKDKLEMIEFLGNGTGELISCDFSKSGLPDIFTIDKKDLLHNKYKHFPHYPAIQVHLNLRYNF… |
| X6LZ33 | 1-183 | None |
| X6LYC8 | 1-223 | None |
| X6LAJ3 | 104-311 | None |
| X6P947 | 309-505 | None |
| X6P5Y4 | 286-475 | None |
| X6P5H6 | 109-267 | None |
| X6NZF7 | 187-363 | None |
| X6NXI3 | 363-546 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.