DPCstruct | MC55075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 267 ± 49 aa |
| Standard deviation of domain lengths | 48.87 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6MKZ6 | 64-301 | LNIVINLFQSLAMLPRVENVLICKETTTEEEVKCTLVRALYCAQLRKQDCLYCLVWPEKLRMVVLIKVVQCFQELFLSPSKSICNFS… |
| U9UC04 | 581-768 | VPNIIMSLYANHGYYPEPWQLLICTSSTTMEELTIFIKRSYFASDNGYEDHLFCIANLELLDFELQYDLVNQIRSMQEQEGYLLALI… |
| A0A8B6EWW3 | 214-520 | None |
| A0A813BCJ7 | 875-1232 | None |
| A0A816PSE3 | 35-246 | None |
| A0A816RN37 | 228-516 | None |
| A0A1X7SNV6 | 3-222 | None |
| A0A816B8K1 | 318-604 | None |
| A0A816ETR7 | 12-228 | None |
| A0A8B6FBA1 | 315-562 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.