DPCstruct | MC55073
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 153 ± 26 aa |
| Standard deviation of domain lengths | 25.78 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 41.05 |
| Pfam Score | 94.29 |
| Assigned Pfam label(s) | PF11708- CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6MFQ4 | 2-152 | AAGIKLGRDDYKKKKELEELRKLGAAPAEVDDEGYIINPHIPQKKDKKKQTNKQTKQMKTISTIKKGYLSDGRPGLRHQRLTSDFSK… |
| A0A183XWV0 | 27-185 | RKSKDEYRRQKDLEEEQKLGIAPATVDVVTGRDINPHIPEFIAKHPWYVPADGPTLQHQRPHEERQIKWSSIDDWYKRGTTNERATK… |
| A0A7S1QWA8 | 46-219 | None |
| A0A7J9FTU6 | 1-116 | None |
| A0A6P4BBD8 | 97-215 | None |
| A0A5B6WH58 | 1-116 | None |
| A0A367JD79 | 1-141 | None |
| S6BPJ4 | 10-164 | None |
| A0A817U1G0 | 17-185 | None |
| A0A6V7NKH6 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.