DPCstruct | MC55071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 202 ± 18 aa |
| Standard deviation of domain lengths | 18.12 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0278 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6M8A0 | 1-240 | MGNICKAESSSEENKYKSEVHGSIFALNKIDKAKLDGMEASYDSVPMEVHTYKDDYENSTKKILEKYTCFTYIFTQEKGERLKKEKE… |
| A0A1E2USY3 | 70-250 | PDMYLEPLDATEACGFGYHRATVDVLTKEKTVSAYTYIGMPDFVDDSCLPSRRYLNILIEGARQAGLDPNFIQSLTKQAVHQAKEYP… |
| A0A177BA47 | 822-1021 | None |
| A0A559PS28 | 67-258 | None |
| A6GAD7 | 76-279 | None |
| A0A7S1CDL4 | 107-289 | None |
| A0A7J6ML73 | 226-442 | None |
| A0A067CTG7 | 1-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.