DPCstruct | MC5507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 307 ± 57 aa |
| Standard deviation of domain lengths | 57.22 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 15.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0123- PF18780 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4INM6 | 20-365 | YNWEAMHFRSRAPNNYWESLENQRHFFDEFARRYHIKEPGDWSKITYSMVLHDGGGSILQRYSSLRDALHAVYPENKEIGLEIKSRA… |
| A0A1W6AJ51 | 6-245 | IEDIYQEILDGKRANFPYFIWSESDNKQFARRVTKYLIEVILNWNTEEIKKSWSGKVIKKYKLAGMVTIVYNASPYAMLNDLYPNRF… |
| F4QAT1 | 183-546 | None |
| A0A3L7D7N1 | 30-278 | None |
| A0A1P8WKU5 | 46-312 | None |
| A0A8A5CSH9 | 253-556 | None |
| A0A6M0R7U9 | 9-394 | None |
| A0A7Z1BDX3 | 10-282 | None |
| K0G022 | 7-332 | None |
| A0A1C5ML70 | 1-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.