DPCstruct | MC55068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 394 ± 44 aa |
| Standard deviation of domain lengths | 43.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.96 |
| Pfam Score | 77.78 |
| Assigned Pfam label(s) | PF02770- CL0016- CL0544 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6M5K4 | 1-463 | MIHSVNLYDVNLVDLVKRESNNNNNNNNNNNGSYGDYVKRLQHRWMTQYERARFEETENETVKQLFAALKQYKRRDFCGDENEPNGL… |
| G0MXI1 | 5-381 | NSDGYMARNLKRWSDAYQMSKTEEIPEMEKLESYLKENLPKSEKSTIVHGDFRIDNLILEENEIKVKGVLDWELSTIGDPLSDLATF… |
| A0A1V9ZX34 | 422-840 | None |
| A0A0B2V3B9 | 345-674 | None |
| A0A446LXM2 | 178-598 | None |
| C3ZV57 | 601-1047 | None |
| A0A2K5KN92 | 413-798 | None |
| A0A2R5GS22 | 243-652 | None |
| A0A6F9BXM3 | 166-522 | None |
| A0A7J8BXF6 | 80-492 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.