DPCstruct | MC55067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 260 ± 24 aa |
| Standard deviation of domain lengths | 23.57 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.74 |
| Pfam Score | 86.61 |
| Assigned Pfam label(s) | CL0489- PF19633 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0XCN3 | 94-357 | AKVTAVDGHYQIGIYTVRPIAEGEEITFDYNSVTESKEEHEASVCLCGSQICRGSYLNFSGEGAFEKVLMEFHGVLDRHSLLLQACE… |
| X6M359 | 9-292 | MQVYSIRDIKCGEELSFDYNSVTEDEQEWKQAVCLCGMKSCRGYYLAYSGSDSYTDVLYKQYHALHRTAVSYRACCSNGDGSEFNDD… |
| A0A7J7N6F9 | 10-228 | None |
| A0A1Y5IHZ3 | 389-688 | None |
| A0A482ST21 | 3-262 | None |
| A0A7J7H116 | 261-515 | None |
| A0A7R9XQY8 | 781-1091 | None |
| A0A2I0IEF1 | 183-453 | None |
| A0A7S1SLP8 | 523-758 | None |
| A0A7S2R0M2 | 40-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.