DPCstruct | MC55066
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 7.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 54.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6LR11 | 79-164 | INNNNSDIITLLSFGGANKHVLVMKYKSVWDNTEQNKKENIIQYNKWIPWTDNFHVSIEIGRKKDDYEGVRAVIGGSNNHLLFIAY |
| X6M1V1 | 1-93 | MGALCSETNNNKDSDQITLLSFGGHCKHTLVMKYASVWSNISNNYNEWISLADNHNHQIVIGRDDDYKGIRAVIGGSNNHLLFITYV… |
| X6P605 | 117-209 | None |
| X6LJX1 | 349-440 | None |
| X6LDB7 | 55-139 | None |
| X6P8W6 | 80-166 | None |
| X6P0T0 | 134-226 | None |
| X6LET4 | 49-137 | None |
| X6MBP6 | 1-72 | None |
| X6M9C6 | 69-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.