DPCstruct | MC55065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 148 ± 22 aa |
| Standard deviation of domain lengths | 21.56 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6M0Q7 | 2-135 | SDDPFPATPKHSVLIHYGLGDAQVSWLGAEEIGRALNAYMFESNVAEYNETLFGFQFIPDSKVINVTQFPGSHLIQGWNFNEPQVPF… |
| A0A4P5W506 | 458-585 | ATQVLWDPVDPASYTAQLAADSRLWQESVGDEQVPNLTTELLMRSVGVTLATPAVNAPVGLNSEAMPFTGSAMTQFDPEEALPDPVN… |
| A0A7S2UIJ9 | 1002-1168 | None |
| A0A2E7UM82 | 43-172 | None |
| A0A538C3T7 | 1-108 | None |
| A0A7W1C7L7 | 93-240 | None |
| A0A7X9KI06 | 24-177 | None |
| A0A7Y1ZI76 | 3-140 | None |
| A0A2A4QZB3 | 4-115 | None |
| A0A537XCA9 | 41-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.