DPCstruct | MC5506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 176 ± 14 aa |
| Standard deviation of domain lengths | 14.23 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 57.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2JV36 | 76-262 | VEEEKRNGEKEFIKAKNIMISAATLGPIKAEVTPKDGGLELKVVDGITFQPTTGQLPRRELVPFLFSVKDLVATAQGSAIDPSTDFE… |
| A0A7S4HH97 | 1-161 | TSYELSGALTVGGAGDVTFVEEDGIDYAPVTVQLPGGERVPFLFTVKELNAKGNLSQFGGDFTVPSYRGATFLDPKGRGNATGYDNA… |
| A0A2U1QA70 | 630-813 | None |
| A0A5N6P711 | 229-402 | None |
| A0A6A3AM89 | 30-211 | None |
| A0A4D4J0M7 | 131-318 | None |
| A0A843V211 | 1-182 | None |
| A0A6A6K4D8 | 210-391 | None |
| A0A2P6TDB7 | 106-289 | None |
| A0A2P6VHT3 | 2-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.