DPCstruct | MC55054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 3.72 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 60.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446K7X1 | 1-68 | MSVLVQEVVSADYAFVIHTTNPSSGESSEIYAEVVKGLGETLVGAFPGRAMSFVCKKDNLDSPRVNQY |
| A0A484LHZ1 | 126-187 | LVQEIINADYAFVIHTTNPSSGDSSEIYAEVVKGLGETLVGAYPGRAMSFTCKKNDLSSPQV |
| A0A5J4KUV5 | 39-104 | None |
| A0A6G1DZ22 | 569-626 | None |
| A0A7J6HB35 | 1-68 | None |
| A0A2P6PQM4 | 52-119 | None |
| A0A444YPG0 | 47-108 | None |
| A0A176VE21 | 770-832 | None |
| A0A161XGW0 | 726-783 | None |
| A0A251TZ24 | 155-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.