DPCstruct | MC5505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 143 ± 12 aa |
| Standard deviation of domain lengths | 12.02 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D8GBA9 | 21-174 | TLPNYNTSHKFELHSNNRVASLLMDMNEYEIWVNNDGFSDNILRTSLLQDIYKRFDDDYDFIFLILNESSIPENLSYYGKLVGVSNN… |
| A0A7K4NDY3 | 62-212 | KDNSTTSYTYNNRDYKILDNGSFVSVLISDSEYSNWDNGSINYISTFSNRTSFFEDVYKIFKDDFDFFIILHNNASLPSTFSYYGLH… |
| A0A2Z5SMR7 | 5-164 | None |
| A0A3B0V9U4 | 44-187 | None |
| A0A7V8BI97 | 149-274 | None |
| A0A2W1AFM7 | 262-411 | None |
| A0A5J6WKZ4 | 197-329 | None |
| A0A3C1JIG3 | 293-436 | None |
| A0A6N8UFX4 | 18-149 | None |
| A0A523F0P4 | 3-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.