DPCstruct | MC55049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 143 ± 33 aa |
| Standard deviation of domain lengths | 32.69 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 55.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M0ZPX1 | 6-107 | KHSVTFLPLQDSRFRETATTGHTWFMSSLNDTREENEAEYLYFPSKASKGRLLCFKGRDMKDGTKNSYALAWRESLPDSAILLEGLT… |
| A0A438G4K0 | 26-157 | WNAGSQESPNCSHELLALAEKLSDAVTFLPLKDLRYAQTAHQGHTWFMSSLYDTHVEGEVQYQQYPSAASRGRLLCIKGRDTHDGAR… |
| A0A1E5VQE3 | 112-281 | None |
| A0A1E5VQD2 | 1-155 | None |
| A0A1S4AIF5 | 58-227 | None |
| A0A6P5N867 | 16-198 | None |
| A0A5N5HQ74 | 1-161 | None |
| A0A7J6E4X1 | 102-229 | None |
| A0A6G1DKD8 | 40-159 | None |
| A0A314UZ27 | 90-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.