DPCstruct | MC55048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 76 ± 11 aa |
| Standard deviation of domain lengths | 11.39 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 36.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04937 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A565BJG5 | 78-145 | REKTVRAIARWIYDAGIPFNCVTYESFDQMLEEIAQYGLGLQPPTMYALRVPLLKKEVDDTHAQLVEH |
| A0A438G3P8 | 8-83 | MPTKRKQEKELVCLSQWMYEAAIPFNAVTYPSFQPMIEAIGQYGVGMKGPTFHEVRVTNLKKELALTKDLMKDHMV |
| U5CUR6 | 1-70 | None |
| W1NFI5 | 2-60 | None |
| W1NKR4 | 1-79 | None |
| A0A6S7NR63 | 219-287 | None |
| A0A3S3Q655 | 178-253 | None |
| A0A484KP05 | 155-226 | None |
| A0A3P6FUU6 | 511-583 | None |
| A0A6A5LFL8 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.