DPCstruct | MC55047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 209 |
|---|---|
| Mean domain length (aa) | 224 ± 52 aa |
| Standard deviation of domain lengths | 51.92 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.24 |
| Pfam Score | 89.40 |
| Assigned Pfam label(s) | PF04990- PF04998- PF04992- PF04983- PF02502 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438G1C6 | 45-234 | IDSNIVRESILRNRRIKLKQQHIKVLDAGKLEVHPQGEGIETVERAVINKDNKVNTGLQTVMGTEGVIGRETTSNHIIEVQQTLGIE… |
| B4R347 | 2-138 | KVLSERDVDPIRTSSNDICEIFQVLGIEAVRKSVEKEMNAVLQFYGLYVNYRHLALLCDVMTAKGHLMAITRHGINRQDTGALMRCS… |
| A0A819MJ77 | 439-709 | None |
| A0A819Q7D7 | 660-856 | None |
| A0A376FII9 | 125-321 | None |
| A0A2T2QWX1 | 2-330 | None |
| A0A7C6Y895 | 966-1213 | None |
| A0A4Z2HLZ3 | 885-1120 | None |
| A0A086JWA6 | 809-1009 | None |
| A0A6J5VGZ0 | 42-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.