DPCstruct | MC55041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 115 |
|---|---|
| Mean domain length (aa) | 231 ± 49 aa |
| Standard deviation of domain lengths | 48.65 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.52 |
| Pfam Score | 83.00 |
| Assigned Pfam label(s) | PF13567- PF03772 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1R5X6 | 9-227 | LWKQAPFIRLLFPLIAGILLQWYLGFSLGYIIICLICFSIALSFYYFLPVSLKYTFRFLQGLLIYFFIASAAMLLTWQADKSKQKSW… |
| A0A5B9WBW9 | 24-297 | PLVPLLIAAVAGIVADRTWDGCTTRSWIDLAFVAAASGLLGLRRPRISSAAMLAAALCLAAGWHHARWSDRAADDIGRLADDTPRPA… |
| A0A2P9IQM8 | 256-495 | None |
| A0A0F7SAU6 | 575-745 | None |
| A0A0B8NQE7 | 2-216 | None |
| A0A0B8PHF8 | 12-221 | None |
| A0A6G8FW65 | 15-258 | None |
| A0A2H5EUA4 | 405-671 | None |
| A0A3D2KSS9 | 124-349 | None |
| A0A419U7G6 | 143-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.