DPCstruct | MC5504
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 223 ± 27 aa |
| Standard deviation of domain lengths | 27.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K4MLX0 | 15-216 | LGFVYLAMGILIGSAVVPIALTILWKRTNRVAATAGAIIGLLIALTTWVSVAASLPEFGGEISLASLGHNYSMLFANVAGIISGGLI… |
| I2JZB8 | 210-421 | IVVNVCVIPMGCTLFWKKMSPLAMTITPYISSAISISVWMGYTYHQSGTINMTTLSTYQALAAGNTVAIGVSGIIAPIIVYIKPSNF… |
| A0A1L9TLJ0 | 429-649 | None |
| A0A1Q9DST8 | 451-692 | None |
| A0A0G4MZB6 | 810-1069 | None |
| G3JTC7 | 439-665 | None |
| H0EZ38 | 2-230 | None |
| A0A3P6GQ96 | 37-249 | None |
| A0A0L8I9N3 | 174-420 | None |
| A0A7S4MPV0 | 164-373 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.