DPCstruct | MC55039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 108 ± 5 aa |
| Standard deviation of domain lengths | 5.37 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.06 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | PF00521- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B6LGQ0 | 206-313 | TKTLDRDIVALMRKRVVDMAGILGKSVNVELNGQKVAAKSFSEYVQLYIDSVSKEGIELPRIYQKVNDRWEVCVSLSEGQFQQVSFV… |
| T0LBA6 | 31-132 | MDRLDEDIVSLLKKRVYDLCGVLKDIKVYLNGQKIEISNFKQYCQLYLNEDSKIIHMRVNNRWELAFTISEEQLQHVAFVNSICTSK… |
| A0A0R3Q3X3 | 31-138 | None |
| A0A072TDW4 | 398-507 | None |
| A0A4U5N2J8 | 87-193 | None |
| A0A6A2Y3Y9 | 32-141 | None |
| A0A811M6U8 | 67-184 | None |
| A0A4S4DL85 | 451-560 | None |
| A0A817CBT0 | 33-139 | None |
| A0A7N2MTT3 | 32-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.