DPCstruct | MC55033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 136 ± 12 aa |
| Standard deviation of domain lengths | 12.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X1PTJ9 | 32-166 | NVTFADGNATKATVSKDAQSGAITVKYDVNVGDGLKLDTANSKIVADTTALTVNSADGDAAKPKGKVAEITDENEKKKLVKAGDLVD… |
| A0A2X1YIX7 | 3-128 | IKPKRAATKLVAGDGVTVESEQLADKSTEYTVSAKTDGATMTTVGGAIAANTTTFNTTTDGAVGAPVTPGALVTAETVQSAINSAGF… |
| A0A448MK91 | 5-144 | None |
| A0A2X1YG87 | 204-326 | None |
| A0A0M3G4R4 | 761-917 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.