DPCstruct | MC55032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 177 ± 27 aa |
| Standard deviation of domain lengths | 27.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.74 |
| Pfam Score | 91.82 |
| Assigned Pfam label(s) | PF05591- PF05943 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X1YIE1 | 27-191 | KTLAQQALENTVTLTSDAYSTIQEIIAEIDRKLSEQINKILHHQEFQALEGAWRGLHYLVNNTETDELLKIRFMDISKKELGRTLKR… |
| A0A827MJL8 | 1-131 | HHPEFQKVESLWRGVKSLVDKTDFRRNVKIELLDLSKDDLRQDFEDAPEIIQSGLYLQTYVAEYDTPGGEPIAALISAWEFDASAQD… |
| A0A336QZL9 | 1-173 | None |
| A0A285Z8U3 | 22-220 | None |
| A0A6J5BUK2 | 51-239 | None |
| A0A447WC42 | 5-232 | None |
| A0A376VPT9 | 2-148 | None |
| A0A2H0IB52 | 3-140 | None |
| A0A5E7MF80 | 46-237 | None |
| A0A7V3JJY5 | 48-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.