DPCstruct | MC5503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 213 ± 16 aa |
| Standard deviation of domain lengths | 16.23 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14402 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C2B2U9 | 16-199 | QLMAALPIGAALTVAARSFLGWRTAGVFAPALLALSLSHLGPSVGGAVLAAGGLAGLAAMPFIDRLALSRIARLALVVCAVCAGVQL… |
| A0A2M7TR93 | 19-235 | VSPILAQSKVIERAITNGVEAKTIVMLLLLPLLATLVSVMHYILGVSGYGIFVPTMIAVALSATGIAGGLILFGAILMISILSNLIL… |
| A0A7C9TTR6 | 53-289 | None |
| A0A1Z8A5X9 | 315-527 | None |
| A0A1P8RE28 | 27-252 | None |
| A0A2H0E054 | 50-282 | None |
| F3KD85 | 4-212 | None |
| A0A7V1GTC7 | 523-725 | None |
| A0A2H0V3V4 | 296-510 | None |
| A0A5E8V3T4 | 13-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.